PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10025872
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family M-type_MADS
Protein Properties Length: 308aa    MW: 33743.9 Da    PI: 6.0662
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10025872genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF54.12e-174291150
                 S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
       SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50
                 k+ie ++n+ +tfskR+ gi  KA+EL +L++ eva ++fs+ gk ++++
  Lus10025872 42 KKIEKETNKMITFSKRKSGIYRKASELVILTGSEVAFLVFSPAGKAFTFA 91
                 68**********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004329.9E-253493IPR002100Transcription factor, MADS-box
PROSITE profilePS5006624.2923494IPR002100Transcription factor, MADS-box
SuperFamilySSF554552.09E-2335114IPR002100Transcription factor, MADS-box
PRINTSPR004042.2E-173656IPR002100Transcription factor, MADS-box
PfamPF003196.5E-204390IPR002100Transcription factor, MADS-box
PRINTSPR004042.2E-175671IPR002100Transcription factor, MADS-box
PRINTSPR004042.2E-177192IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 308 aa     Download sequence    Send to blast
MEFVPNNIHD DISSNSDGED TSTAINRPVA KKTRGRRKIE MKKIEKETNK MITFSKRKSG  60
IYRKASELVI LTGSEVAFLV FSPAGKAFTF AHPSFDYIAK KYLGLQNQDP SIMSYGPVVV  120
LRQARTSEAT IRYRESLEGF DNDTKRQRDL LARMERKALD NWWNRCIDYV HGYEIQGLED  180
AYLEVTNKVE LKRMEVRLGI NGLNTTAGSG SDPFASGSHP SENIQLLPQP PVDMGPQAGL  240
MNMGQPNLTH SLPNFSAGDP ENMEVLNGGD GGERAEASDP LSLFGSVGGG NGGVGYSSSI  300
FSFPPVE*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1mnm_A3e-14321041486PROTEIN (MCM1 TRANSCRIPTIONAL REGULATOR)
1mnm_B3e-14321041486PROTEIN (MCM1 TRANSCRIPTIONAL REGULATOR)
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60440.11e-20AGAMOUS-like 62